SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016018 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016018
Domain Number 1 Region: 162-265
Classification Level Classification E-value
Superfamily Immunoglobulin 2.98e-19
Family C2 set domains 0.066
Further Details:      
 
Domain Number 2 Region: 261-353
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000109
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 68-165
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000743
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016018   Gene: ENSNLEG00000013186   Transcript: ENSNLET00000016836
Sequence length 430
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:9677413:9707546:1 gene:ENSNLEG00000013186 transcript:ENSNLET00000016836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPAASLLLLLFACCWAPGGANLSQDGYWQEQDLELGTLAPLDEAISSTVWSSPDMLAS
QDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTS
TPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTA
TLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGANIV
CSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWE
KEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSST
YHAIIGGIVAFIVFLLLIMLIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQS
GWDDKKEYFI
Download sequence
Identical sequences G1RRZ6
ENSNLEP00000016018 ENSNLEP00000016018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]