SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016030 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016030
Domain Number 1 Region: 45-171
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.29e-29
Family DnaQ-like 3'-5' exonuclease 0.000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016030   Gene: ENSNLEG00000013237   Transcript: ENSNLET00000016849
Sequence length 171
Comment pep:known_by_projection supercontig:Nleu1.0:GL397458.1:59731:62572:-1 gene:ENSNLEG00000013237 transcript:ENSNLET00000016849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGAGGPLPRWSWRTDDCGSRSRCSPTLAAALLTCCPRGNITMSEAPRAETFVFLDLEAT
GLPSVEPEIAELSLFAVHRSSLENLERDESGAPVLPRVLDKLTLCMCPERPFTAKASEVT
GLSSDGLARCRKGFDGAVVRTLQAFLSRQAPICLVAHNGFAYDFPLLCAEL
Download sequence
Identical sequences ENSNLEP00000016030 ENSNLEP00000016030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]