SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016078 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016078
Domain Number 1 Region: 116-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000271
Family C2 set domains 0.079
Further Details:      
 
Domain Number 2 Region: 29-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000214
Family I set domains 0.0045
Further Details:      
 
Domain Number 3 Region: 212-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000652
Family I set domains 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016078   Gene: ENSNLEG00000013276   Transcript: ENSNLET00000016899
Sequence length 414
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:10278038:10292688:1 gene:ENSNLEG00000013276 transcript:ENSNLET00000016899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSLGPMLLWTAVLLFVPCVGKTAWLYLQAWPNPVFEGDALTLRCQGRKNTSLSQVRFY
RDGKFLHLSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTPTQTSETVMVQVQELFPSPV
LSAIPSPEPRVGSLVILRCQTKLHPLRSASRLLFSFHKDGHTLQDRGPHSELCIPGVKEG
DSGLYWCEAAPEGGQVRKQSPQLEVRVQAPVSPPVLTLHHGPADPAVGDMVQLLCETQRG
SPPILYSFYLDEKIVGNHSAPYGGTASLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLS
LNGSQVLSTPTSSNWLVPWLPASLLGLMVIAATLLVYLRPWRKAGPLPSQIPPTSPGGEQ
CPLYANAHKAKNINKPLKLSTCNRCSKQGVLLPAEFTAGRKFYHLCRGEMPAAQ
Download sequence
Identical sequences ENSNLEP00000016078 ENSNLEP00000016078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]