SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016085 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016085
Domain Number 1 Region: 35-332
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.24e-108
Family Inorganic pyrophosphatase 0.0000000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016085   Gene: ENSNLEG00000013175   Transcript: ENSNLET00000016906
Sequence length 334
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:26449521:26553934:1 gene:ENSNLEG00000013175 transcript:ENSNLET00000016906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRMLRTGAPAAACLRLGTSAGTRPRRAMSLYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKVNSKEENGIPTKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQY
VKDGRLRYVANIFPYKGYIWNYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSC
GEVIHVKILGILALIDEGETDWKLIAINANDPEASKFHDIDDVKKFKPGYLEATLNWFRL
YKVPDGRPENQFAFNGEFKNKAFALEVIKSTHQRWKALLMKKCNGGAINCTNVQISDSPF
RCTQEEARSLVQSVSSSPNKESNEEEQVWHFLGK
Download sequence
Identical sequences G1RS63
XP_003257507.1.23891 ENSNLEP00000016085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]