SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016087 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016087
Domain Number 1 Region: 26-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000996
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 
Domain Number 2 Region: 146-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000257
Family C1 set domains (antibody constant domain-like) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016087   Gene: ENSNLEG00000013286   Transcript: ENSNLET00000016908
Sequence length 280
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:10303997:10314419:1 gene:ENSNLEG00000013286 transcript:ENSNLET00000016908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRPLWSLLLWEALLPIAVTGAQVLSKVGDSVLLVAARPPGFQVREAIWRSLWPSEELL
ATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGHPWTQTLQLK
VYDAVPRPVVQVFIAVGGDAQPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLF
TDGQVLSVSLGPGDRDVAYSCIVSNPVSWDLATVTPWYSCHYKAGMLRASSQWKNFLFLN
SLPFQGVTFFLMSLSGKKKKDVRADRVGPETENPLVQDLP
Download sequence
Identical sequences ENSNLEP00000016087 ENSNLEP00000016087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]