SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016111 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016111
Domain Number 1 Region: 52-195
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-33
Family C-type lectin domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016111   Gene: ENSNLEG00000013297   Transcript: ENSNLET00000016933
Sequence length 197
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:35583382:35591678:1 gene:ENSNLEG00000013297 transcript:ENSNLET00000016933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKE
MQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALRDYGKR
SLPGVNDFWLGINDMVTEGKFVDVNGVAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSD
EACRSSKRYICEFSIPQ
Download sequence
Identical sequences XP_003260029.1.23891 ENSNLEP00000016111 ENSNLEP00000016111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]