SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016139 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016139
Domain Number 1 Region: 23-139,329-637
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.45e-72
Family Integrin alpha N-terminal domain 0.0000538
Further Details:      
 
Domain Number 2 Region: 159-353
Classification Level Classification E-value
Superfamily vWA-like 3.06e-51
Family Integrin A (or I) domain 0.000000892
Further Details:      
 
Domain Number 3 Region: 637-783
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-30
Family Integrin domains 0.0053
Further Details:      
 
Domain Number 4 Region: 784-797,826-945
Classification Level Classification E-value
Superfamily Integrin domains 1.26e-21
Family Integrin domains 0.0042
Further Details:      
 
Domain Number 5 Region: 964-1145
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000152
Family Integrin domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016139   Gene: ENSNLEG00000013220   Transcript: ENSNLET00000016963
Sequence length 1188
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:12110633:12245576:-1 gene:ENSNLEG00000013220 transcript:ENSNLET00000016963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGKKWLVVGA
PLETNGHQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQALRGQQIGSYF
GSEITSVDIDSDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNRFVYNGTLKDSHSYQNA
RFGSSIASVRDLNQDSYDDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQIKASLHFEPTKINIFHRDCK
RSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAV
LLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLEDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRRRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKKVCNVSYPFF
RAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTREDNVAPLRFHLKYEADVLFT
RSSSLSHYEVKPNSSLERYNGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLL
KLRDFLTHQANTSCNIWGNSTEYRPTPMEEDLSRAPQLNHSNSDVVSINCNIRLAPNQEI
NFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFKSARRRREPGLEPTPKVLE
Download sequence
Identical sequences G1RSB7
ENSNLEP00000016139 ENSNLEP00000016139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]