SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016198 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016198
Domain Number 1 Region: 832-1119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-78
Family Protein kinases, catalytic subunit 0.000000000339
Further Details:      
 
Domain Number 2 Region: 558-737
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-27
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 445-584
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000299
Family Fibronectin type III 0.008
Further Details:      
 
Domain Number 4 Region: 353-451
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000197
Family I set domains 0.035
Further Details:      
 
Domain Number 5 Region: 134-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000025
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016198
Domain Number - Region: 316-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000366
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 215-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00816
Family Growth factor receptor domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016198   Gene: ENSNLEG00000013277   Transcript: ENSNLET00000017026
Sequence length 1138
Comment pep:known_by_projection supercontig:Nleu1.0:GL397442.1:175196:197696:1 gene:ENSNLEG00000013277 transcript:ENSNLET00000017026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWRVPPFLLPILFLASHAGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVH
NSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYNLDWHEAQDGRFLL
QLPNVQPLSSGIYSATYLEASPLGSAFFRLIVRGCVAGRWGPGCTKECPGCLHGGVCHDH
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL
EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPDKTTAEFEVPRLVLAD
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQIVVSPLVSFSGDGPISSV
RLHYRPQESTMDWSTIVVDPSENVTLMNLRPKTGYSVCVQLSRPGEGGEGAWGPPTLMTT
DCPEPLLQPWLEGWHVEGPDRLRVSWSLPLVPGPLVGDGFLLRLWDGARGQERRENISSP
QARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI
QLTWQHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRVRA
SVQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Download sequence
Identical sequences ENSNLEP00000016198 ENSNLEP00000016198 XP_012367001.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]