SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016201 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016201
Domain Number 1 Region: 167-270
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000322
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 2 Region: 361-549
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000801
Family Fibronectin type III 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016201
Domain Number - Region: 256-351
Classification Level Classification E-value
Superfamily Fibronectin type III 0.024
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016201   Gene: ENSNLEG00000013354   Transcript: ENSNLET00000017029
Sequence length 676
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:5155536:5314268:1 gene:ENSNLEG00000013354 transcript:ENSNLET00000017029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDAWPESPAPIMDSPLLDARAREAIGPTGTSPGGLPSCPASPLGAPFWPWPLPKLALL
PLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRCNKTQT
VAVAAGRSWVAIPREQLTVSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFS
EDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEAELKTIPLAPVAIQDLELAT
GYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGMPGGDEPLLLWKAPGP
CVQVSYKVWFWVGGRELNPEGITCCCSLIPSGAEWARVSAVNATSWEPLTNLSLVCLDSA
SAPRSVAVSSIAGSTELLVTWRPGPGEPREHVVDWARDGDPLEKLNWVRLPPGNLSALLP
GNFTVGVPYRITVTAVSASGLASAPSIWGFREELAPLVGPTLWRLQDAPPGTPVIAWGEV
PRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDLPWGPCELWVTASTIAGQGPP
GPILQLHLPDNTLRWKVLPGVLFLWGLFLMGCGLSLATSGRCYHLRHKVLPRWVWEKVPD
PANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESSQPPQATAPLDSGYEKHFLPT
PEELGLLGPARPQVLA
Download sequence
Identical sequences ENSNLEP00000016201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]