SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016206 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016206
Domain Number 1 Region: 480-818
Classification Level Classification E-value
Superfamily Folate-binding domain 2.04e-84
Family Aminomethyltransferase folate-binding domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 67-288,388-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.39e-51
Family FAD-linked reductases, N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 288-387
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-29
Family L-aminoacid/polyamine oxidase 0.0058
Further Details:      
 
Domain Number 4 Region: 820-914
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000000458
Family Aminomethyltransferase beta-barrel domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016206   Gene: ENSNLEG00000013366   Transcript: ENSNLET00000017034
Sequence length 916
Comment pep:known_by_projection supercontig:Nleu1.0:GL397403.1:3360417:3434281:-1 gene:ENSNLEG00000013366 transcript:ENSNLET00000017034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALRVAAAHPRQSPTRGVGPFNLSNAAGPTAEKSVPHQRTLKEGQGTSVVAQGPS
RPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRVVSRDLEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESH
VLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGI
RVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTER
IEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTPH
IEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGEALGEAG
AEHRAWLVAPRTHRLMPSSAQPRFHHSLTDHPRWIRERSHESYAKNYSVAFPHDEPLAGR
NMRKDPLHEELLEQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYGRL
LADEYTFAFPPHHDTIKKECLACRGAAAVFDMYFGKFYLVGLDARKAADWLFSADVSRPP
GSTVYTCMLNHRGGTESDLTVSRLAPSHQASPLAPAFEGDGYYLAVGGAVAQHNWSHITT
VLQDQKFQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGHLV
RAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLVNAGYRAIDSLSIEKGYRHWHA
DLRPDDSPLEAGLAFTCKLKSPVPFLGREALQQQRAAGLRRRLVCFTVEDKVPMFGLEAI
WRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVRSGDYALERMGVTYGARAH
LKSPFDPNNKRMKGIY
Download sequence
Identical sequences ENSNLEP00000016206 ENSNLEP00000016206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]