SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016224 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016224
Domain Number 1 Region: 1935-2215
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-77
Family Protein kinases, catalytic subunit 0.000000245
Further Details:      
 
Domain Number 2 Region: 100-280
Classification Level Classification E-value
Superfamily Fibronectin type III 8.55e-26
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 3 Region: 1658-1846
Classification Level Classification E-value
Superfamily Fibronectin type III 4.66e-22
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 960-1149
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-21
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 1154-1420
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000353
Family YWTD domain 0.011
Further Details:      
 
Domain Number 6 Region: 677-901
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000994
Family YWTD domain 0.0028
Further Details:      
 
Domain Number 7 Region: 557-676
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000111
Family Fibronectin type III 0.0074
Further Details:      
 
Domain Number 8 Region: 1481-1642
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000159
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 9 Region: 293-513
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000144
Family YWTD domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016224   Gene: ENSNLEG00000013311   Transcript: ENSNLET00000017055
Sequence length 2347
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:8909944:9051410:-1 gene:ENSNLEG00000013311 transcript:ENSNLET00000017055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNVYCLIPKLVHFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQG
CYFWNSVDQKNCALKCRESCEVGCSSAEGAYEEEVLENADLPTAPFASSIGSHNMTLRWK
SANFSGVKYIIQWKYAQLLGSWTYTKTVSRLSYVVEPLHPFTEYMFRVVWIFTAQLQLYS
PPSPSYRTHPHGVPETAPLIRNIESSSPDTVEVSWDPPQFPGGPILGYNLRLISKNQKLD
AGTQRTSFQFYSTLPNTIYRFSIAAVNEVGEGPEAESSITTSSSAVQQEEQWLFLSRKTS
LRKRSLKHLVDEAHCLRLDAVYHNITGISVDVHQQIVYFSEGTLIWAKKAANMSDVSDLR
IFYRGSGLISSISIDWLYQRMYFIMDELVCVCDLENCSNVEEISPPSISAPQKIVADSYN
GYVFYLLRDGIYRADLPVPSGRCAEAVRIVESCTLKDFAIKPQSKRIIYFNDTAQVFMST
FLDGSASHLILPRIPFADVKSFACENNDFLVTDGKIIFQQDALSFNEFIVGCDLSHIEEF
GFGNLVIFGSSSQLHPLPGRPQELSVLFGSHQALVQWKPPALAIGANVILTSDIIELFEL
GPSAWQNWTYEVKVSTQDPPEVTHIFLNVSGTVLNVPELQSATKYKVSVRASSPKRPGPW
SEPSVGTTLVPASEPPFIMAVKEDGLWSKPLNSFGPGELLSSDIGNVSDMDWYNNSLYYS
DMKGDIFVWLLNGTDISENYHLPSIAGAGALAFEWLGHFLYWAGKTYVIQRQSVLTGHTD
MVTHVKLLVNDMVVDSVGGYLYWTTLYSVESTRLNGESSLILQAQPWFSGKKVIALTLDL
SDGLLYWLVQDSQCIHLYTAVLRGKSTGDTTITEFAAWSTSEISQNALVYYSGRLFWING
FRIITTQEIGQKTSVSVLEPAKFNQFTIIQTSLKPLPGNFSFTPKVIPDSVQESSFRIEG
NASSFQILWNGPPAVDWGVVFYSVEFSAHSKFLASEQHSLPVFTVEGLEPYTLFNLSVTP
YTYWGKGPKTSLSLRAPETVPSAPENPRIFILPSGKCCNKNEVVVEFRWNKPKHENGVLT
KFEIFYNISNQSITNKTCEDWIAVNVTPSVMSFQLEGMSPGCFVAFQVRAFTSKGPGPFA
DVVKSTTSEINPFPHLITLLGNKIVFLDMDQNQVVWAFSAARIISAICYTADNEMGYYAE
GNSLFLLNLHNRSSSKLFQDSLVFDITVITIDWISRHLYFALKESQHGMQIFDVDLEHKV
KYPREVKIHNRNSTIISFSVYPLLSRLYWTEVSSFGYQMFYYSIINHTLHQIVQPTATNQ
QNKRNQCSCNVTEFELSGAMAIDTSNLEKPLIYFAKAQEIWAMDLEGCQCWRVITVPAML
AGKTLVSLTVDGDFIYWIITANDSTQIYQAKKGNGAIISQVKALRSRHIVAYSSVMQPFP
DKAFLSLASDTVEPTILNATNTSLTIRLPLAKTNLTWYGITSPTPTYLIYYAEVNDRKNS
SDLKYRILEFQDSIALIEDLQPFSTYMVQIAVKNYYSDPLEHLPPGKEIWGKTKNGVPEA
VQLINTTVRSDTSLIISWRESHKPNGPRESVRYQLAISHLALIPETPLRQSEFPNGRLTL
LVTRLSGGNIYVLKVLACHSEEMWCTESHPVTVEMFNTPEKPYSLVPENTSLQFNWKAPL
NVNLIRFWVELQKWKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENST
SLPESFKTKAGVPSKPGIPKLLEGSKNSIQWEKAEDNGCRIIYYILEIRKSTSNNLQNQN
LRWKMTFNGSCSSVCTWKSKNLKGIFQFRVVAANNLGFGEYSGISENIILVGDDFWIPET
SFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLAN
ACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVK
TLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRK
ARMATYYGPLLTLVDLVDLCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRIVKI
GDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQ
PYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDHRPTFHRIQDQLQLFRN
FFLNSIYQCRDEANTSGVINEGFEGEDGDVICLNSDDIMPVALMETKNPEGLNYMVLATQ
CGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHS
GYGDGSD
Download sequence
Identical sequences G1RSK1
ENSNLEP00000016224 XP_003255666.1.23891 ENSNLEP00000016224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]