SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016231 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016231
Domain Number 1 Region: 521-715
Classification Level Classification E-value
Superfamily Fibronectin type III 4.58e-24
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 2 Region: 126-226
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-21
Family I set domains 0.0094
Further Details:      
 
Domain Number 3 Region: 226-325
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-19
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 416-505
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000172
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 28-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000106
Family V set domains (antibody variable domain-like) 0.059
Further Details:      
 
Domain Number 6 Region: 312-407
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000163
Family I set domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016231   Gene: ENSNLEG00000013353   Transcript: ENSNLET00000017062
Sequence length 1179
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:10408749:10427315:-1 gene:ENSNLEG00000013353 transcript:ENSNLET00000017062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWCLGLAVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRF
GFLLPIFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPED
DFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQG
QGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSTTHATQLLVLGPPVIVVPPKNSTVNA
SQDVSLACHAEAYPANLTYSWFQDNINVFHIRRLQPRVRILVDGSLRLQATKPDDAGCYT
CVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKD
GKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAF
IERPKEEYFQEVGRELLIPCSAQGDPPPVVSWAKVGRGLQGQAQVDSNSSLILRPLTKEA
HGRWECSASNAVARVATSTNIYVLGTSPHVVTNVSVVPLPKGANVSWEPGFDGGYLQRFS
VWYTPLAKRPDRMHHDWVSLAVPVGAAHLLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVL
SAPEGLPTTPAAPRLPPTEIPPPLSPPRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEG
RQGSQGWEVLDPAVAGTETELLVPGLIKDVLYELRLVAFAGSFVSDPSNTANVSTSGLEV
YPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAACLMNRRRAARRRRKRLRQDPPLI
FSPTGKSAAPSALGSGSPDSVAKLKLQGSPVASLRQSLLWGDPAGNPSPHPDPPSSRGPL
PLEPICRGPDGRFVMGPTVAAPQERSGPEQAEPRTPAQRLARSFDCSSSSPSGAPQPLCI
EDISPVAPPPAAPPSPLPGPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRR
CPTSSFLRSPDTPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLLPAAPRGS
LTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASGPERWPRREHVVTVSKRRNT
SVDENYEWDSEFPGDMELLETLHLGLASSRLRPEAEPELGVKTPEEGCLLNTAHVTGPEA
RCAALREEFLAFRRRRDATRARLPAYRQPVPHPEQATLL
Download sequence
Identical sequences ENSNLEP00000016231 ENSNLEP00000016231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]