SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016233 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016233
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-39
Family Link domain 0.009
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-24
Family Link domain 0.0027
Further Details:      
 
Domain Number 3 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 9.96e-16
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016233   Gene: ENSNLEG00000013393   Transcript: ENSNLET00000017065
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:16166552:16251463:-1 gene:ENSNLEG00000013393 transcript:ENSNLET00000017065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLVLISICWADHLSDNYTLDHDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTLDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDN
DASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences G1RSL0
ENSNLEP00000016233 ENSNLEP00000016233 XP_003261612.1.23891 XP_012361042.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]