SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016235 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016235
Domain Number 1 Region: 1467-1573
Classification Level Classification E-value
Superfamily C-type lectin-like 1.65e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000383
Further Details:      
 
Domain Number 2 Region: 1574-1688
Classification Level Classification E-value
Superfamily C-type lectin-like 4e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016235   Gene: ENSNLEG00000013384   Transcript: ENSNLET00000017067
Sequence length 1690
Comment pep:known_by_projection supercontig:Nleu1.0:GL397366.1:305782:453299:-1 gene:ENSNLEG00000013384 transcript:ENSNLET00000017067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSLHIELMRCSFRLIKSLATGPWSLILILFSVQYVYGSGKKYVGPCGGRDCSVCHCVPE
KGSRGPPGPPGPQGPIGPLGAPGPIGLSGEKGMRGDRGPPGAAGDKGDKGPTGVPGFPGL
DGIPGHPGPPGPRGKPGMSGHNGSRGDPGFPGGRGALGPGGPPGHPGEKGEKGNSVFILG
AIKGIQGNRCTDFSHVQGSWGAGGPAGPTGYPGEPGLVGPPGQPGRPGLKGNPGVGVKGQ
MGDPGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGTIGLPGPPGRKGESGTGAKGEK
GIPGFPGPRGDPGSYGSPGFPGLKGELGLVGDPGLFGLIGPKGDPGNRGRPGPPGVLVTP
PLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPGE
AGIPGRPDSAPGKPGKPGSPGLPGAPGLQGLPGSSVTYCSVGNPGPQGIKGKVGPPGGRG
SKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDPGPPGAEGPPGLP
GKHGASGPPGNKGAKGDMVVSRVKGHKGERGPDGPPGFPGQPGSHGRDGHAGEKGDPGPP
GDHEDATPGGKGFPGPLGPPGKAGPVGPPGLGFPGPPGQRGHPGVPGRPGVRGPDGLKGQ
KGDTISCNVTYPGRQGPPGFDGLPGPKGFPGPQGAPGLSGSDGHKGRPGTPGTSEIPGPP
GFRGDMGDPGFGGERGSSPVGPPGPPGSPGVNGQKGIPGDPAFGPLGPPGKRGLSGVPGI
KGPRGDPGCPGAEGPAGIPGFPGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPGL
PGYPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPGP
PGPKGPRGLPGFPGFPGERGKPGADGCPGTKGEPGEKGMSGLPGDRGLRGAKGATGPPGD
EGEMAIISIKGKPGEPGPPGDDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGEPGEKG
QPGPPGPPGPPGSTGLRGFIGFPGLPGDQGEPGSPGIPGFSGIDGARGPKGNKGDPASHF
GPPGPKGEPGSPGCPGHFGASGEQGLPGIQGPRGSPGRPGPPGSSGPRGCPGDHGMPGLR
GQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKGASGLHDVGPPG
PVGIPGLKGERGDPGSPGISPPGPCGEKGPPGSPGRSGPPGPAGATGRAPKDIPDPGPPG
DQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGPPGPPGPPGYKGFPGCDGKD
GQKGPMGFPGPQGPHGFPGPPGEKGLPGPPGRKGATGLPVPISGEPGPPADVDDCPRIPG
LPGAPGMRGPEGAMGPPGMRGPPGPGCKGEPGLDGRSGVDGVPGSPGPPGHKGDTGEDGY
PGGPGPPGPIGDPGPKGFGPGYLSGFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQE
KAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIR
PYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPG
SCLEDFRAAPFLECQGRQGTCHFFANEYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKI
SRCQVCLKHS
Download sequence
Identical sequences ENSNLEP00000016235 ENSNLEP00000016235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]