SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016236 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016236
Domain Number 1 Region: 22-128
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-24
Family Fibronectin type III 0.00094
Further Details:      
 
Domain Number 2 Region: 132-179,240-285,381-435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000263
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016236
Domain Number - Region: 288-365
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00123
Family Fibronectin type III 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016236   Gene: ENSNLEG00000013413   Transcript: ENSNLET00000017068
Sequence length 437
Comment pep:known_by_projection supercontig:Nleu1.0:GL397442.1:214552:222851:1 gene:ENSNLEG00000013413 transcript:ENSNLET00000017068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLICFWDEEEAAPN
GTYQLLYAYPGEKPRACPLSSQSVPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQNR
TQRVLFVDSVGLPAPPSMIKAMSGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPVLQRPHSASALDQSPCAQPAVPWQDGPKQTSPSREASALTAVGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVAIGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGAVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKV
Download sequence
Identical sequences ENSNLEP00000016236 ENSNLEP00000016236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]