SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016240 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016240
Domain Number 1 Region: 31-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000227
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 2 Region: 308-410
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000267
Family V set domains (antibody variable domain-like) 0.018
Further Details:      
 
Domain Number 3 Region: 450-555
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000136
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016240
Domain Number - Region: 169-286
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000129
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016240   Gene: ENSNLEG00000013416   Transcript: ENSNLET00000017072
Sequence length 622
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:10425445:10595810:-1 gene:ENSNLEG00000013416 transcript:ENSNLET00000017072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALRPTLLPPSLPLLLLLLMLGMGCWAREVLVPEGPLYRVAGTAVSISCNVTGYEGPAQ
QNFEWFLYRPEAPDTALGIVSTKDTQFSYAVFKSRVVAGEVQVQRLQGDAVVLKIARLQA
QDAGIYECHTPSTDTRYLGSYSGKVELRVLPDVLQVSAAPPGPRGRQAPTSPPRLMVHEG
QELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLA
AGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQ
TLSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPAGAPGPGRLV
AQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRL
REAASARSRPLPVHVREEGVVLEAVAWLAGGTVYRGETASLLCNISVRGGPPGLRLAASW
WVERPEDGELSSVPAQLVGGVGQDGVAELGVRPGGGPVSVELVGPRSHRLRLHSLGPEDE
GVYHCAPSAWVQHADYSWYQAGSARSGPVTVYPYMHALDTLFVPLLVGTGVALVTGATVL
GTITCCFMKRLXTPALTPQGFK
Download sequence
Identical sequences ENSNLEP00000016240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]