SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016241 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016241
Domain Number 1 Region: 27-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000135
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 129-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000153
Family C1 set domains (antibody constant domain-like) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016241   Gene: ENSNLEG00000013423   Transcript: ENSNLET00000017073
Sequence length 285
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:10434407:10439148:-1 gene:ENSNLEG00000013423 transcript:ENSNLET00000017073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAFPWLFLLLLLREGDQRGLRRCGSEEVVAVLWESIXLPLEITPDEEENIIWSSHKSLA
TVVGKEGHPATIMVTNPHYQGRVSFLDPSYSLHISNLSWEDSGLYQAQVNLRTSQISTIQ
QYNLRVYRRLSEPHITVNFESSGEGACNMSLVCSVEKAGMDVTYSWLSQGDSAYTFHEGP
VLSTSWRPGDSALSYTCRANNPICNVSSRPIPAGPFCADPNYASEKPSTAFCLLAKGLLI
LLLFVILAVGLWVIRVQKRHKMPRMKKLMRNMKLRKEAKPGSSPA
Download sequence
Identical sequences ENSNLEP00000016241 ENSNLEP00000016241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]