SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016298 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016298
Domain Number 1 Region: 65-153
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-26
Family C1 set domains (antibody constant domain-like) 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016298   Gene: ENSNLEG00000013452   Transcript: ENSNLET00000017132
Sequence length 202
Comment pep:novel supercontig:Nleu1.0:GL400067.1:3634:5903:-1 gene:ENSNLEG00000013452 transcript:ENSNLET00000017132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVPTIKIKFQADETVRPHGQLCWRPTQGQSLGLQRSRQKAKQGDLLCLHDSFPLPCFLLV
HPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVKWFRNGQEEKAGVVSTGLIQNGDWTF
QTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGA
GLFIYFRNQKGHSGLQPTDFLS
Download sequence
Identical sequences ENSNLEP00000016298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]