SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016348 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016348
Domain Number 1 Region: 1355-1667
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.07e-112
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000119
Further Details:      
 
Domain Number 2 Region: 1631-1923
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.62e-86
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000584
Further Details:      
 
Domain Number 3 Region: 327-521
Classification Level Classification E-value
Superfamily Fibronectin type III 3.13e-44
Family Fibronectin type III 0.00048
Further Details:      
 
Domain Number 4 Region: 519-716
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-43
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 5 Region: 837-1027
Classification Level Classification E-value
Superfamily Fibronectin type III 6.19e-25
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 701-833
Classification Level Classification E-value
Superfamily Fibronectin type III 4.17e-18
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 7 Region: 31-125
Classification Level Classification E-value
Superfamily Immunoglobulin 6.85e-18
Family I set domains 0.0043
Further Details:      
 
Domain Number 8 Region: 135-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000108
Family I set domains 0.018
Further Details:      
 
Domain Number 9 Region: 239-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000002
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016348
Domain Number - Region: 1064-1112
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0285
Family Fibronectin type III 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016348   Gene: ENSNLEG00000013443   Transcript: ENSNLET00000017187
Sequence length 1926
Comment pep:known_by_projection supercontig:Nleu1.0:GL397500.1:721789:863789:-1 gene:ENSNLEG00000013443 transcript:ENSNLET00000017187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSGEFPSEPHRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA
PRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVK
DSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITITWDSGNPDPVSYYV
IEYKSKSQDGPYQIKRTSTTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQ
APASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSL
LTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSVTLS
WGPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQGLGA
FTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSE
DPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPP
RKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQW
ETDDTAEYVSSAPGHLPPTTAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQT
PEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHKGATYVF
RLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIV
KYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSP
PVRYRTFLRDQVWGQGSVRLGLSQSWGLSLGSGISQSSPGPQIQYNGLTLDVDGRTTKKL
ITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFNLLNGKPSVAPKPDADGFIMVYLPDG
QSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISRLQRRSLRHSRQLEVP
RPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAASPFSDP
FQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLL
NNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPIADMAEHTERLKANDSLKLSQEYESID
PGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIVGSDYINANYVDGYRRQNAY
IATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLL
DTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPD
AGPVVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFI
HEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISAN
LPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRRCHAFPTSGPQKEPIS
ALKRPPWINNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILRE
FKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSA
GVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGS
FDHYAT
Download sequence
Identical sequences ENSNLEP00000016348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]