SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016375 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016375
Domain Number 1 Region: 152-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.6e-59
Family Astacin 0.0000888
Further Details:      
 
Domain Number 2 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 779-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 468-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 353-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-35
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 6 Region: 909-1002
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-30
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 7 Region: 729-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000326
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 573-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016375   Gene: ENSNLEG00000013436   Transcript: ENSNLET00000017215
Sequence length 1013
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:29877864:30031094:-1 gene:ENSNLEG00000013436 transcript:ENSNLET00000017215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRATALGALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAV
FWGDIALDEDDLKLFHIDKARWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAGK
DGQENTTLLHSPGTSHAAAETSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQ
AMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAH
ELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYA
RNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNF
SAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLL
GRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAVYEATCGGDINKDAGQIQSPNYPD
DYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYE
KPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCA
CDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQF
EVFELEGNDVCKYDFVEVRSGLSPEAKLHGKFCGSETPEVITSQSNNMRVEFKSDNTVSK
RGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYRLHDNGHDCKEAGCAHKISS
AEGTLTSPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDS
LAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRTGFQAVHSTECGGRLKAEVQTKEL
YSHAQFGDNNYPSQAHCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYLEAYDGYDSSAP
RLGRFCGSGPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences G1RT01
ENSNLEP00000016375 ENSNLEP00000016375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]