SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016398 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016398
Domain Number 1 Region: 33-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000216
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016398   Gene: ENSNLEG00000013502   Transcript: ENSNLET00000017238
Sequence length 199
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:183412:187905:-1 gene:ENSNLEG00000013502 transcript:ENSNLET00000017238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGPGVLQALPATIFLLFLLSAAYLGPGCQALWVHGGPTSLMVSLGEDAHFQCLHNGSK
NANVTWWRVLHGNYTWPPEFLGPGEDLNGTLIIQNVNKSHGGIYVCRVQEGNKTYRQSCG
TYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGD
EYEDENLYEGPEPGRLFHV
Download sequence
Identical sequences ENSNLEP00000016398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]