SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016422 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000016422
Domain Number - Region: 92-191
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0994
Family beta-lactamase inhibitor protein-II, BLIP-II 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016422   Gene: ENSNLEG00000013545   Transcript: ENSNLET00000017266
Sequence length 240
Comment pep:known_by_projection supercontig:Nleu1.0:GL397376.1:5141178:5161127:1 gene:ENSNLEG00000013545 transcript:ENSNLET00000017266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPASNGVFVVILPSNASGLCPPPAIPPTSMCQPPGIMQFEEPPLGVQIPRATQPPDL
QPVETFLTGEPKVLGTVQILIGLIHLGFGSVLLLVRRGHVGIFFIEGGVPFWGGACFIIS
GSLSVAAEKNHASCLVRSSLGTNILSVVVAFAGTAILLMDFGVTNWDVDRGYLAVLTIFT
ILEFFIAVTATHFGCQATHAQASAPVIFLPNAFTADFNIPSPAASPPPAYDNVAYAQGVV
Download sequence
Identical sequences G1RT48
XP_003275277.1.23891 ENSNLEP00000016422 ENSNLEP00000016422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]