SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016446 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016446
Domain Number 1 Region: 14-159
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.94e-31
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016446   Gene: ENSNLEG00000013588   Transcript: ENSNLET00000017290
Sequence length 175
Comment pep:known_by_projection supercontig:Nleu1.0:GL397447.1:1485662:1486441:1 gene:ENSNLEG00000013588 transcript:ENSNLET00000017290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPAEAGRRGAASPVPPPFVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRA
PGVAELRVPVFDDPAEDLLAHLEPTCAAMEAAVRAGGACLYCINGSSRSAALCTAYLMRH
RGLSLTQAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA
Download sequence
Identical sequences G1RT72
ENSNLEP00000016446 ENSNLEP00000016446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]