SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016462 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016462
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Immunoglobulin 6.94e-21
Family V set domains (antibody variable domain-like) 0.00054
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016462
Domain Number - Region: 137-177
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.0942
Family MAPEG domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016462   Gene: ENSNLEG00000013590   Transcript: ENSNLET00000017306
Sequence length 243
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:313885:385575:1 gene:ENSNLEG00000013590 transcript:ENSNLET00000017306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPSAAPHGGHRPWQGLLITASLLTFWDPPTTVQFTIEAMPSSAAEGQDVLLPACNISE
TIQAYYWHKGKTAEGSPLVAGYITDIQANIPGVAHTGRERVYSNGSLLFQNITLEDAGPY
TLRTIDSNYDSDATGQLHVHQNYVPGLPVGAVAGIMTGVLVGVALVAALACFLLLSRTGR
ASTQRDLREQQPPASTPGHGPSHRSTFSXXXXQPQNSTPIYEELLHSDANSYCRIDRKAD
VVS
Download sequence
Identical sequences ENSNLEP00000016462 ENSNLEP00000016462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]