SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016474 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016474
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-24
Family V set domains (antibody variable domain-like) 0.00069
Further Details:      
 
Domain Number 2 Region: 142-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000543
Family I set domains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016474   Gene: ENSNLEG00000013606   Transcript: ENSNLET00000017318
Sequence length 264
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:333139:343978:1 gene:ENSNLEG00000013606 transcript:ENSNLET00000017318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLSACPHRVCIPWKGLLLTASLLTFWNLPTSAQTTIEVMPFNVAEGKEVLLLVHNESQ
NLYGYNWYKGERVHANYRIIGCVINDQENAPGPAHNGRETIYPNGSLLIQNVTHNDAGIY
TLHVINKDLVNEEVTSQFYVFSVPPKPSITSNNFNPVENKDIVALTCQPETQNTTYLWWV
NNQSPLVSPRLLLSTDNRTIVLLSVTKNDRGSYECEIQNPVGASRSDPVILNVRSESVQA
SSPDLSAGTAISLIIGVLAGMALI
Download sequence
Identical sequences G1RTA0
XP_004091051.1.23891 XP_004091052.1.23891 ENSNLEP00000016474 ENSNLEP00000016474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]