SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016534 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016534
Domain Number 1 Region: 92-260
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-28
Family Toll/Interleukin receptor TIR domain 0.00086
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016534
Domain Number - Region: 15-47
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00143
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016534   Gene: ENSNLEG00000013656   Transcript: ENSNLET00000017380
Sequence length 386
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:1978957:2005998:1 gene:ENSNLEG00000013656 transcript:ENSNLET00000017380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLKEHLGEKEVELALIFDSVVEADLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGG
LGAIFLLLVLLVVVYKCYNIELMLFYRQHFGADETNDDNKEYDAYLSYTKVDQDTLDCDN
PEEEQFALEVLPDVLEKHYGYKLFIPERDLIPSGTYMEDLTRYVEQSRRLIIVLTPDYIL
RRGWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVESLKRSIKLLSLIKWKGPK
SSKLNSKFWKHLVYEMPIKKKEMLSRCHVLDSAEQGLFGELQPIPSIAMTSTSATLVSSQ
ADLPEFHPSDSMQMRHCCRGYKHETPTTTLPVPSLGNHHTYCNLPLTLLNGQLPLNNTLK
DTQEFHRNSSLLPLSSKEFSFTSDIW
Download sequence
Identical sequences ENSNLEP00000016534 ENSNLEP00000016534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]