SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016536 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016536
Domain Number 1 Region: 30-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000245
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016536
Domain Number - Region: 145-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00119
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016536   Gene: ENSNLEG00000013641   Transcript: ENSNLET00000017382
Sequence length 332
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11014874:11044573:-1 gene:ENSNLEG00000013641 transcript:ENSNLET00000017382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLFQSLLFVFCFGPGNVVSQSSSTPLMVNGILGESVTLPLELPAGEKVNSITWLCNGT
SLAFIVLCETKSPEIHITNPKQGKRLNFTQSYSLQLSNLEMEDTCSYSAQISTETSSKLS
SYTLRILRQLRNIQVTSHSQLFQNKTCELHLTCSVEDADDNASLRWEALGNTLSSQPNFT
ISWDPRISSEQDYNCIAENAVSNLSFSVSAQKLCGGVKIQYTDIKMIPFMVSGICIVTIF
IILLLLVLRKRRDSLPLSTQRTQGSAESAGNIEYVSVSPTNNTVYASVTHSNRETEIWTP
IKNDTITIYSTINHSKESKPTFSRATALDNVV
Download sequence
Identical sequences ENSNLEP00000016536 ENSNLEP00000016536 XP_003258760.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]