SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016553 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016553
Domain Number 1 Region: 625-810
Classification Level Classification E-value
Superfamily Fibronectin type III 9.23e-25
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 2 Region: 250-339
Classification Level Classification E-value
Superfamily Immunoglobulin 4.08e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 434-524
Classification Level Classification E-value
Superfamily Immunoglobulin 5.87e-17
Family I set domains 0.061
Further Details:      
 
Domain Number 4 Region: 326-422
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 518-615
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 31-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000167
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 801-896
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000188
Family Fibronectin type III 0.00029
Further Details:      
 
Domain Number 8 Region: 139-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000291
Family I set domains 0.049
Further Details:      
 
Domain Number 9 Region: 972-1089
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000788
Family Fibronectin type III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016553   Gene: ENSNLEG00000013647   Transcript: ENSNLET00000017399
Sequence length 1256
Comment pep:known_by_projection supercontig:Nleu1.0:GL397458.1:471176:497524:-1 gene:ENSNLEG00000013647 transcript:ENSNLET00000017399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVALRYVWPLLLCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEAS
GKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKL
GTAMSHEIRLMAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIK
QDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKP
RLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLL
QVGEEDDGEYRCLAENSLGSARHAYYVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRP
QPEVTWRINGIPVEELAKDQKYRIQRGALILSNAQPSDTMVTQCEARNRHGLLLANAYIF
VVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANG
TLGIRDLQANDTGRYFCLVANDQNNVTIVANLKVKDATQITQGPRSAIEKKGSRVTFTCQ
ASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVV
ESRAQLLVVGSPGPVPRLVLSDLHLLTQSQVRVSWSPAEDHNAPIESKRLELGATPPSPL
PALXXGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVD
VKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQWRPQRTRGPWQEQIVSDPFLLVSNTST
FVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEIFNSSAVLVKWRPVDLAQ
VKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVLANTTSVILSGLRPYSYHLEVQPLTGG
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKL
QCGGIPFNLRDPELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFG
NISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQ
PDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATEGWFIGFVSAIILLLLALLILC
FIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGDIKP
LGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE
Download sequence
Identical sequences ENSNLEP00000016553 ENSNLEP00000016553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]