SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016569 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016569
Domain Number 1 Region: 131-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000101
Family I set domains 0.051
Further Details:      
 
Domain Number 2 Region: 28-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000366
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016569   Gene: ENSNLEG00000013660   Transcript: ENSNLET00000017416
Sequence length 345
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11071949:11102604:-1 gene:ENSNLEG00000013660 transcript:ENSNLET00000017416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHNLWILLLCLQTWPEAAGKDSEILTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSV
AYVKPGDSETAPIVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQTDPYTT
TKLYSLQVYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQI
FQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLIL
SSVFLFHLFKRRKGRIFPEGSCLNTFTKNPYAASKKTIYTYITASRNTQPAESRIYDEIL
QSKVLPSKEEPVNTVYSEVQFTDKMGKASTQDSKPPATSSYEIVI
Download sequence
Identical sequences ENSNLEP00000016569 ENSNLEP00000016569 XP_003258764.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]