SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016594 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016594
Domain Number 1 Region: 1361-1672
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000167
Further Details:      
 
Domain Number 2 Region: 1638-1915
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000011
Further Details:      
 
Domain Number 3 Region: 362-556
Classification Level Classification E-value
Superfamily Fibronectin type III 3.05e-47
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 4 Region: 516-647
Classification Level Classification E-value
Superfamily Fibronectin type III 2.98e-27
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 5 Region: 749-911
Classification Level Classification E-value
Superfamily Fibronectin type III 3.85e-27
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 6 Region: 936-1037
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-25
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 7 Region: 76-178
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-18
Family I set domains 0.003
Further Details:      
 
Domain Number 8 Region: 274-367
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 179-271
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 1045-1127
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000554
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016594   Gene: ENSNLEG00000013649   Transcript: ENSNLET00000017442
Sequence length 1916
Comment pep:known_by_projection supercontig:Nleu1.0:GL397442.1:430427:512408:1 gene:ENSNLEG00000013649 transcript:ENSNLET00000017442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQGAQPRNCSQASSSPAPCSSPTFSPQVDCPGLWLAVELEPWMAPEPAPGRTMVPLVP
ALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEPKPRITWMKKGKKVSSQ
RFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLEEEQLPPGFPS
IDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATSNGRIKQLRSGALQIES
SEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVNLTCVAV
GAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVAISSLGMIEATAQVTVK
ALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTEGPFQEVDGVATTRYSI
GGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEP
PEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGD
GPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERIIMYELVYWAAEDEDQQ
HKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEARTAQSSKCLPSPLPVTP
GLGHTHTRAHILPSRPGGRGTVSCEVAERARQGPETGSMESGGLKPVHCSRVLGGRGVWT
HHWTRGDTCLPPNSQGSFCCARLSQVPSGPPRKVEVEPLNSTAVHVYWKLPVPSKQHGQI
RGYQVTYVRLENGEPRGLPIIQDVMLAEAQETTISGLTPETTYSVTVAAYTTKGDGARSK
PKIVTTTGAVPGRPTMMISTTAMNTALLQWHPPKELPGELLGYRLQYCRADEARPNTIDF
GKDDQHTVTAALESTCRMQAADKNRAGLGEEFEKEIRTPEDLPSGFPQNLRVTGLTTSTT
ELAWDPPVLAERNGRITSYTVVFRDINSQEELQNVTTDTRFTLTGLKPDTTYDIKVRAWT
SKGSGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKILYNGQS
VEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQHLVSIRTAPDLLPHKPLPASAYIE
DGRFALSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELELDELLEAIEQGGEE
QRRRRRRQAERLKPYVFISLGASRSWGSTKDPRSVPGITRPWDPEARPNVAPGTHLLFST
GPQKRYASSPYSDEIVVQVTPAQQQEEPEMLWVTGPVLAVILIILIVIAILLFKREHCPQ
SSGNGHLPLAFQALSGSSVPASMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGLKFS
QEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDG
YRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETYG
LIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRV
KACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQT
EDQYVFIHEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLAVGAHTS
RFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQG
PLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNM
PQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGP
ITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYHL
Download sequence
Identical sequences ENSNLEP00000016594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]