SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016599 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016599
Domain Number 1 Region: 136-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000531
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016599
Domain Number - Region: 81-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00336
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016599   Gene: ENSNLEG00000013683   Transcript: ENSNLET00000017447
Sequence length 328
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11140969:11206248:-1 gene:ENSNLEG00000013683 transcript:ENSNLET00000017447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTFIIYLSLLMGLRRPTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMA
KSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVS
VQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNP
ANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGG
VIMILIMVVILQLRRRGKTDHYQTTMEKKSLTIYAQVQKPGPLQKKLDPFPAQDPCTTIY
VAATEPVPESVQETNSITVYASVTLPES
Download sequence
Identical sequences ENSNLEP00000016599 ENSNLEP00000016599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]