SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016629 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016629
Domain Number 1 Region: 89-214,319-417,532-688
Classification Level Classification E-value
Superfamily L domain-like 1.07e-60
Family Ngr ectodomain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 1150-1339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-44
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 759-898
Classification Level Classification E-value
Superfamily L domain-like 5.31e-34
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 4 Region: 1005-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000373
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 5 Region: 923-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 6 Region: 1046-1164
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 965-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000077
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 1337-1375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016629
Domain Number - Region: 1380-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1424-1455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000376
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016629   Gene: ENSNLEG00000013653   Transcript: ENSNLET00000017477
Sequence length 1534
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:30522998:30715118:-1 gene:ENSNLEG00000013653 transcript:ENSNLET00000017477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTPGWGSSAGPVRPELWLLLWAAAWRLGASACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEIQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQI
RSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEASVVECSSLKLTKIPERIPQ
STAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL
QSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLCSLRLLSLH
GNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPPDME
GKLLLTTPAKKFECQGSPTLAVQAKCDPCLSSPCQNQGTCHNDPLEVYKCACPSGYKGRD
CEVSLDSCSSGPCENGGTCHAQEGEDAAFTCSCPTGFEGPTCGVNTDDCVDHACANGGVC
VDGVGNYSCQCPLQYEGKTCEQLVDLCSPDLNPCQHEAQCVGTPDGPRCECMPGYAGDNC
SENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPAPKSPCEGTECQNGA
NCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDN
GILLYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVAFDQMVNL
SIDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYIN
NELQDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGP
CHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAVALAEPCRGLQCLHGHCQASGTKGA
HCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQG
LRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA
Download sequence
Identical sequences G1RTQ5
ENSNLEP00000016629 XP_003255326.1.23891 ENSNLEP00000016629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]