SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016634 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016634
Domain Number 1 Region: 1005-1186
Classification Level Classification E-value
Superfamily Fibronectin type III 3.59e-18
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 697-766
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000737
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 754-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000075
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 311-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000977
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 5 Region: 386-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 6 Region: 792-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 909-987
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000762
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 8 Region: 830-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 582-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000357
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 660-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000447
Family EGF-type module 0.022
Further Details:      
 
Domain Number 11 Region: 543-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 12 Region: 430-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000954
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1310-1345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000037
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 351-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000511
Family EGF-type module 0.027
Further Details:      
 
Domain Number 15 Region: 272-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000127
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 16 Region: 870-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 620-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000616
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 473-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000383
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016634
Domain Number - Region: 508-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0143
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016634   Gene: ENSNLEG00000013708   Transcript: ENSNLET00000017482
Sequence length 1413
Comment pep:known_by_projection supercontig:Nleu1.0:GL397447.1:1899116:1995917:1 gene:ENSNLEG00000013708 transcript:ENSNLET00000017482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHGVAWALLVAAALGLGARGVRGAVALADFYPFGAERGDAVTPKQDDGGSGLRPLSVPF
PFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYRE
ATDPATLRRATEDVRRYFPELLDFSATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDGK
LSFTIFNYESIVWTTGTHASSGGNATGLGGIAAQAGFNAGDGQRYFSIPGSRTADMAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLALRPCLNGGKCIDDCVTGNPSYTCSCL
SGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPAGFGGSTCETAQSPCDTKECQH
GGQCQVENGSAVCVCQAGYTGAACETDVDDCSPDPCLNGGSCVDLVGNYTCLCAEPFKGL
RCETGNWPTGDACLSAPCHNGGTCVEADQGYVCECPEGFMGLDCRERVPDDCECRNGGRC
LGANTTLCQCPPGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHS
VPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGG
EYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDXXTQWPGPSCILAAPS
PCFRSPCVNGGTCEDRGTDFFCHCQAGYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAV
ALYACDRGYSLSAPSRVRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQDRVAGYLCLC
STGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCPAGFVGVHCETEVDACDSSPCQ
HGGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTG
KDCAKELFPPTALKMERVEEAGFSISWNPPDGPAARQMLDGYAVTYVSSDGSYRRTDFVD
RTRSSHQLRALAAGRAYNISVFSVKRNSNNKNDISRPAMLLARTRPRPVEGFEVTNVTAS
TISVQWVLHRIHHATVSGVRVSIRHPEALRDQATDVDRSVDRFTFGALLPGRRYTIQLTT
LSGLRGEEHPTESLATAPTHVWTRPLPPANLXXSRVTATSAHVVWDAPTPGSLLEAYVIN
VTTSQSTKSRYVPSGKLVSYTVRDLLPGRRYQLSVTAVQSTELGPLHSEPAHLYIITXXX
XXXXXRWHQGGHHPRVLRNRPPPARLPELRLLNDHDAPETPTQPPRFSELVDGRGRVSAR
FGGPPSKAATVRSQPTASAQLENTEEAPAVSLTLQLPEHGNKDIGNVPGNCSENPCQNGG
TCVPGADTHRCDCGPGFKGRRCELACVKVSRPCTRLFSETKSFPVWEGGVCHHVYKRVYR
VHQDICFKESCEGTSLKKTPNRKQSKSQTLEKS
Download sequence
Identical sequences ENSNLEP00000016634 ENSNLEP00000016634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]