SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016637 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000016637
Domain Number - Region: 98-179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000173
Family C2 set domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016637   Gene: ENSNLEG00000013702   Transcript: ENSNLET00000017485
Sequence length 306
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11195794:11213729:1 gene:ENSNLEG00000013702 transcript:ENSNLET00000017485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSPTCLTVIYILWQLTGSAASGPVKELVGSVGGAVTFPLESEVKQVDSIVWTFNTTPL
LQCGGIPYKNEDSALNYCFLSTIGRVSTSGCPSSFAEHLSKPKVTMGLQSNENGTCVTNL
TCCMEHGEEDVIYTWKALGQEANESHNGPILPISWRWGESDMAFICVARNPVSSNFSSPI
LARKLCGGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEESIEEKKRADICR
ETPNICPHSGENTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRPF
AYENVI
Download sequence
Identical sequences ENSNLEP00000016637 ENSNLEP00000016637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]