SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016705 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016705
Domain Number 1 Region: 219-330
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.8e-25
Family Protein kinases, catalytic subunit 0.0016
Further Details:      
 
Domain Number 2 Region: 73-141
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000942
Family DEATH domain, DD 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016705
Domain Number - Region: 496-560
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00413
Family Protein kinases, catalytic subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016705   Gene: ENSNLEG00000013767   Transcript: ENSNLET00000017556
Sequence length 738
Comment pep:known_by_projection supercontig:Nleu1.0:GL397458.1:628612:637622:-1 gene:ENSNLEG00000013767 transcript:ENSNLET00000017556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGIFLGSGHSGGGFWEESPTGASCGPWALLVSRKSPKSVGLGVGNPFAVRIKRARGTVA
GGDIQLEKQKTALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRA
RDIITAWHPPAPLPSPSTTAPRPSSIPAPAEAEAEAWSPRKLPSSAATLLSPAFPGYQTH
SGPELGLVPSPASLRPPPPSPAPSSTKPGPESSVSLLQGAHPSPFCWPLCEISQGTHNFS
EELKIGEGGFGCVYRAVMRNTVYAVKRLKEDADLEWTAVKQSFLTEVEQLSRFRHPNIVD
FAGYCAQNGFYCLVYGFLPNGSLEDRLHCQVGSPGPARFPGPKALLTSGWSRARDLGLSA
SVSLHFQLPSSTPLRIWPTVGSLFFFFFFFFFFLRALSQASPVCKQRSWRNAFKDFPTTR
DKGMSPGSRSPAYSIERVVLETLAGQRAVKTHGARTKYLKDLVEEEAEEAGVAFRSTQST
LQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGRLACCCLHRRAKRRPPMTQVY
ERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGGAHSGAAPWQPLAVPSGASAQAA
EQLQRGPNQPVESDESLGGLSAALHSWHLTPSCPLDPGPLREAGCPQGDTAGESSCESGP
GFRPTALEGLAPGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPAE
LGLEQDRQGPEESDEFQS
Download sequence
Identical sequences ENSNLEP00000016705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]