SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016709 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016709
Domain Number 1 Region: 305-616
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.2e-74
Family FMN-linked oxidoreductases 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016709
Domain Number - Region: 119-149
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00144
Family CCCH zinc finger 0.0052
Further Details:      
 
Domain Number - Region: 161-180
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0235
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016709   Gene: ENSNLEG00000013734   Transcript: ENSNLET00000017560
Sequence length 649
Comment pep:known_by_projection supercontig:Nleu1.0:GL397500.1:1302416:1309485:-1 gene:ENSNLEG00000013734 transcript:ENSNLET00000017560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGTAAAPLENGGGGDSGVGALERGVAPIKPQYLTTKEQFHQFLEAKGQEKPCRETEVG
EPAGNDLAEPEAKRIRLEDGQTADGQTEEAAEPGEQPQTQKRARGQNKGRPHVKPTHYDK
NRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFA
GAHLGPEGQNLVQEELAARGAQPPSVRNGLDKALQQQLRKREVRFEQAEQALRRFSQVQP
PGPTPAAAVAEGAPRQDNCGAQQVPAGLGTSTPPSSPVRTCGPLTDEDVVRLQPCEKKRL
DIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDI
FGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIV
RGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQY
IEECVKAASPMPLFGNGDILSFEDANRAMQTGVAGIMIARGALLKPWLFTEIKEQRHWDI
SSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINER
PPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPNFAFLPKHKANAYK
Download sequence
Identical sequences G1RTY5
XP_003280631.1.23891 ENSNLEP00000016709 ENSNLEP00000016709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]