SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016726 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000016726
Domain Number - Region: 28-90
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0115
Family Rabaptin-5 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016726   Gene: ENSNLEG00000013795   Transcript: ENSNLET00000017577
Sequence length 125
Comment pep:novel supercontig:Nleu1.0:GL397500.1:1392208:1398074:1 gene:ENSNLEG00000013795 transcript:ENSNLET00000017577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALPALIQEANAHLAAVHRRAAERTVHAQAEHLALHDQQLRAAVDELGRAKDCETATLQ
EQLMTSQATVHSLQATVHPGDELIRQLQPRAELLQDICRRRPPLAALLDALAEAGCVPLP
CNPPG
Download sequence
Identical sequences ENSNLEP00000016726 ENSNLEP00000016726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]