SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016742 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016742
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000167
Family RING finger domain, C3HC4 0.0000291
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016742
Domain Number - Region: 87-112,145-179
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0759
Family CorA soluble domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016742   Gene: ENSNLEG00000013781   Transcript: ENSNLET00000017593
Sequence length 309
Comment pep:known_by_projection supercontig:Nleu1.0:GL397312.1:11565462:11807990:1 gene:ENSNLEG00000013781 transcript:ENSNLET00000017593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRV
QLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKK
KMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNK
QAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHK
LEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
FSGLFWQPS
Download sequence
Identical sequences A0A024R688 A0A0D9RNW3 A0A2I3TVA9 A0A2K5IUK1 A0A2K5LLH4 A0A2K6Q4S8 G1RU18 G7PAG6 H9EPT3 P51948
NP_001248725.1.72884 NP_002422.1.87134 NP_002422.1.92137 XP_001167724.1.37143 XP_003267815.1.23891 XP_003831682.1.60992 XP_005267744.1.92137 XP_005561488.1.63531 XP_007985077.1.81039 XP_008955233.1.60992 XP_010352938.1.97406 XP_011725873.1.29376 XP_011817330.1.43180 XP_011817331.1.43180 XP_011917409.1.92194 XP_012359945.1.23891 ENSMMUP00000002190 ENSNLEP00000016742 ENSNLEP00000016742 gi|4505225|ref|NP_002422.1| ENSP00000261245 ENSPTRP00000010879 ENSPTRP00000010879 ENSP00000261245 ENSP00000261245 ENSMMUP00000002190 HR4460 IGBMC-0029-000 OPTIC1561 9544.ENSMMUP00000002190 9598.ENSPTRP00000010879 9606.ENSP00000261245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]