SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016769 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016769
Domain Number 1 Region: 35-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000151
Family I set domains 0.046
Further Details:      
 
Domain Number 2 Region: 153-215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000416
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016769   Gene: ENSNLEG00000013786   Transcript: ENSNLET00000017621
Sequence length 370
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11283179:11313467:-1 gene:ENSNLEG00000013786 transcript:ENSNLET00000017621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGQVVTLILLLFLKGYQGKGCQGTGDPVVSISGVPLQLQPNSTQMKVDSVQWKMWLPSQ
NEFHEILKWENDSLPSNTSNDRFSFTVKNLSLLIKAAQQQDSGLYCLEVTSVSGNVQTAK
FQVFVFESLLPDKVEKPCLQGQGKILDRGRCQVALSCSVSGDGNVTYAWYRGSKLIQTAG
NLTRLEEEVDIDSTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSTL
FLGTLACFCVWRRKRKGKQSETNPKEFLTIYEDVKDLKTRRNQEQEQTFPGGGTTIYSMI
QSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSSSFNSTIYEVIGKSQPKAQNPARLSR
KELENFDIYS
Download sequence
Identical sequences G1RU44
XP_003258769.1.23891 ENSNLEP00000016769 ENSNLEP00000016769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]