SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016858 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016858
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily PR-1-like 9.29e-28
Family PR-1-like 0.00063
Further Details:      
 
Domain Number 2 Region: 231-373
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-26
Family C-type lectin domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016858   Gene: ENSNLEG00000013877   Transcript: ENSNLET00000017711
Sequence length 383
Comment pep:novel supercontig:Nleu1.0:GL398037.1:5099:14772:1 gene:ENSNLEG00000013877 transcript:ENSNLET00000017711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWSDSLAQLAQARAAHCGTPTLSLASAPWHTLQVGWNVQLLPAGSASFVEVVSLWFAEGQ
RYSHAAGECARNANCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPGGNWEVNG
KTIIPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCP
PGYTGRYCQVRCSLRCVHGRFREEECSCVCDVGYGGAQCATKVHFPFHTCDLRIDGDCFM
VSSEADTYYRARMKCQRKGGVLAQIESQKVQDILAFYLGRLETTNEVTDSDFETRNFWIG
LTYKTAKDSFRWATGEHQAFTSFAFGQPNNQGLVWLSAAMWFGNCVELQASAAFNWNDQR
CKTRNRYICQFAQEHISRWGPGS
Download sequence
Identical sequences ENSNLEP00000016858 ENSNLEP00000016858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]