SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016930 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000016930
Domain Number - Region: 46-67
Classification Level Classification E-value
Superfamily Elafin-like 0.0196
Family Elafin-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016930   Gene: ENSNLEG00000013951   Transcript: ENSNLET00000017785
Sequence length 107
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:29421823:29426897:1 gene:ENSNLEG00000013951 transcript:ENSNLET00000017785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLPTATRATLILSLAFASLHSACLAEASSSNSSTLTAHHPDPGTLEQCLNVDFCPQAA
RCCRTGVDEYGWIAAAVGWSLWFLTLILLCVDKLMKLTPDEPKDLQA
Download sequence
Identical sequences A0A2I3GL91
ENSNLEP00000016930 ENSNLEP00000016930 XP_003261447.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]