SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016950 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016950
Domain Number 1 Region: 90-394
Classification Level Classification E-value
Superfamily L domain-like 2.89e-57
Family Leucine rich effector protein YopM 0.06
Further Details:      
 
Domain Number 2 Region: 489-629
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.57e-36
Family Gelsolin-like 0.00027
Further Details:      
 
Domain Number 3 Region: 1055-1165
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3e-25
Family Gelsolin-like 0.00082
Further Details:      
 
Domain Number 4 Region: 609-720
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.25e-23
Family Gelsolin-like 0.00077
Further Details:      
 
Domain Number 5 Region: 6-139
Classification Level Classification E-value
Superfamily L domain-like 1.17e-19
Family Internalin LRR domain 0.066
Further Details:      
 
Domain Number 6 Region: 750-858
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.7e-19
Family C-terminal, gelsolin-like domain of Sec23/24 0.01
Further Details:      
 
Domain Number 7 Region: 889-944,996-1045
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000015
Family Gelsolin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016950   Gene: ENSNLEG00000013949   Transcript: ENSNLET00000017808
Sequence length 1170
Comment pep:known_by_projection supercontig:Nleu1.0:GL397474.1:1716505:1732941:-1 gene:ENSNLEG00000013949 transcript:ENSNLET00000017808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LSGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADMDLSCNDLTRVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLN
SNKLDFDGLPSGIGKLTNLEEFMAANNNLELIPESLCRCPKLRKLVLNKNRLVTLPEAIH
FLTEIEVLDVRENPNLVMPPKPTDRAAEWYNIDFSLQNQLLLAGASPATVAAAAAAGSGP
KDPMARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPGGKVRRWDQGL
EKPRLDYSEFFTEDVGQLPGLTIWQIENFMPVLVEEAFHGKFYEADCYIVLKTFLDDSGS
LNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISY
IEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGASLDPRFVFLLDRGLDIYVWR
GAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWDALGGEPSEIKKHVPDD
FWPPQPKLAGLVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILD
CWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPLHATVSRSLEGTEAQVFKAKFKNWD
DVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMLLAEAEQLMEE
WNEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKA
EGKEGEEATAEAEEKQPEEDFQCIVYFWQGRPFESEDNQGIVYAWVGRASDPDEAKLAED
ILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVT
EKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERP
RRLRLVRKGNEQHAFTRCFHAWSAFRKALA
Download sequence
Identical sequences ENSNLEP00000016950 ENSNLEP00000016950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]