SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016956 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016956
Domain Number 1 Region: 244-350
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-29
Family Cadherin 0.00091
Further Details:      
 
Domain Number 2 Region: 451-575
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-27
Family Cadherin 0.00095
Further Details:      
 
Domain Number 3 Region: 352-455
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 568-680
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 116-242
Classification Level Classification E-value
Superfamily Cadherin-like 6.06e-19
Family Cadherin 0.0082
Further Details:      
 
Domain Number 6 Region: 18-114
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016956   Gene: ENSNLEG00000013967   Transcript: ENSNLET00000017814
Sequence length 1040
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:7071205:7115196:1 gene:ENSNLEG00000013967 transcript:ENSNLET00000017814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVLLLFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSR
TPYLDLNLETGVLYVNEKIDRERICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPP
SFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRF
AELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRV
LDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRAREL
FGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISF
STVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAP
LDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGA
YIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFS
FQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLL
TRVAAVDADDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIEV
RDHGQPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQRPSRSGGGETSLDLTLILII
ALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCCGGGGSTCCGRQARARKK
KLSKSDIMLVQSSNVPSNPAQVPVEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKPC
SPSRSTDTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQRAELSYLVDRPRRVNSSAF
QEADIVSSKDSGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHSDRCWMPSFVP
SDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDG
LLSNTRAPYKPPYLTRKRIC
Download sequence
Identical sequences XP_003264709.1.23891 ENSNLEP00000016956 ENSNLEP00000016956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]