SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016967 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016967
Domain Number 1 Region: 508-686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-45
Family SPRY domain 0.003
Further Details:      
 
Domain Number 2 Region: 195-260
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 31-118
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000109
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 4 Region: 405-513
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000184
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016967
Domain Number - Region: 136-191
Classification Level Classification E-value
Superfamily RING/U-box 0.00247
Family ZZ domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016967   Gene: ENSNLEG00000013959   Transcript: ENSNLET00000017827
Sequence length 715
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:4046214:4142099:1 gene:ENSNLEG00000013959 transcript:ENSNLET00000017827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDSCFVFLADESPASVVLNASGGLFSLKMETLESELTCPICLELFEDPLLLPCAHSLC
FSCAHRILVSSCSSGESIEPITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKAS
VSGPNSPSESRRERTYRPSTAMSSERIACQFCEQDPPRDAVKTCITCEVSYCDRCLRATH
PNKKPFTSHRLVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVA
SLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELV
EIIQQRKQMIAVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQ
SAKNIAERVAMATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREE
LCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYTV
HGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDE
SSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGK
NASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFD
VTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH
Download sequence
Identical sequences ENSNLEP00000016967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]