SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017056 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017056
Domain Number 1 Region: 25-101
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000141
Family DEATH effector domain, DED 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017056   Gene: ENSNLEG00000014017   Transcript: ENSNLET00000017916
Sequence length 347
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11560407:11573230:-1 gene:ENSNLEG00000014017 transcript:ENSNLET00000017916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLEDKYLEE
TSFPYVSPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRR
KSVTPDPKEKQTCGEEVQGFQRWSRLEEYKELLGHWAVYAIQYIRLRVRAEYCQHETALQ
GNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEA
LKGVFITDSLKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP
Download sequence
Identical sequences G1RUX9
ENSNLEP00000017056 ENSNLEP00000017056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]