SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017086 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017086
Domain Number 1 Region: 51-188
Classification Level Classification E-value
Superfamily L domain-like 6.5e-26
Family Ngr ectodomain-like 0.0094
Further Details:      
 
Domain Number 2 Region: 429-515
Classification Level Classification E-value
Superfamily Fibronectin type III 5.5e-16
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017086   Gene: ENSNLEG00000014071   Transcript: ENSNLET00000017947
Sequence length 590
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:510244:521280:-1 gene:ENSNLEG00000014071 transcript:ENSNLET00000017947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLAGNPLQALQPRAFACLPALRLLNLCTALGRGARGGIAEAAFAGEEGAPLATLEVLDLS
GTFLERVESGWIRDLPKLTSLYLRKMPRLTTLEGDIFKMTPNLQQLDCQDSPALASVATH
IFQDTPRLQVLLFQNCNLSSFPPWTLDSSQVLLINLFGNPLTCSCDLSWLLTDAKRTVLS
RAADTVCAPAAGSSGPFSASLSLSLSLSQLPGVCQSDQSTTLRASHPPCFNRSTYAQGPT
VAPSAAPATRPAGDQQSVSKARNVGARTLAAWPHSDAREGTAPSTTNSVAGHSNSSVFPR
AASTTRTQHRGEHAPGLALEPDISAASTPLASKLLGPFPTSWNLISSPQPGQRTHATPQA
PNPSPSEGEIPVLLLDDYSEEEEGRKEEVGTPHQDVPCDYHPCKHLQTPCAELQRRWRCR
CPGLSGEDTIPDPPRLQGVTETTDTSAVVHWCTPKSVVHGYQIRYSAEGWAGNQSVVGVI
YATARQHPLYGLSPGTTYRVCVLAANRAGLSQPRSSGWRSPCAAFTTKPSFALLLSGLCA
ASGLLLASTVVLSACLCRRGQTLRLQRCGTHLVAYKNPAFDYPLGLQTVS
Download sequence
Identical sequences ENSNLEP00000017086 ENSNLEP00000017086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]