SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017100 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017100
Domain Number 1 Region: 5-326,438-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.02e-49
Family FAD-linked reductases, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 312-416
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.04e-18
Family L-aminoacid/polyamine oxidase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017100   Gene: ENSNLEG00000014066   Transcript: ENSNLET00000017961
Sequence length 476
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11611014:11615719:1 gene:ENSNLEG00000014066 transcript:ENSNLET00000017961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYRGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEVSGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKVSWL
KHSFHPFLPESARQFLSAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Download sequence
Identical sequences ENSNLEP00000017100 ENSNLEP00000017100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]