SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017135 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017135
Domain Number 1 Region: 168-260
Classification Level Classification E-value
Superfamily Immunoglobulin 2.92e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 259-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 313-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 4 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000158
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 841-878
Classification Level Classification E-value
Superfamily DEATH domain 0.000000365
Family DEATH domain, DD 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017135   Gene: ENSNLEG00000014104   Transcript: ENSNLET00000017996
Sequence length 879
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:36348133:36750353:1 gene:ENSNLEG00000014104 transcript:ENSNLET00000017996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKGLRATAARCGLGLGYLLQMLVLPALATSPRISLGSCFSDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALNLKNQSLARQTDPSCTAFGSFNSLG
GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
LTRPVVLTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
TENLSTYALVGHSTTKAAAKRLKLVIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQ
MGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCT
FTLERFSLNTGELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRWV
Download sequence
Identical sequences ENSNLEP00000017135 ENSNLEP00000017135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]