SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017155 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017155
Domain Number 1 Region: 37-151
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-16
Family Growth factor receptor domain 0.00073
Further Details:      
 
Domain Number 2 Region: 146-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017155   Gene: ENSNLEG00000014120   Transcript: ENSNLET00000018017
Sequence length 292
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:18851850:18933107:1 gene:ENSNLEG00000014120 transcript:ENSNLET00000018017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMECVNIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREII
QHPSAKGNLCLPTNETRRCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLES
SKEIPEQRENKQQQKKRKVQDKQKSGIEVTLAEGLTSASQRTQPTPCRRRYL
Download sequence
Identical sequences G1RV78
ENSNLEP00000017155 ENSNLEP00000017155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]