SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017219 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000017219
Domain Number - Region: 5-26
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0463
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017219   Gene: ENSNLEG00000014096   Transcript: ENSNLET00000018083
Sequence length 810
Comment pep:known_by_projection supercontig:Nleu1.0:GL397353.1:5863832:5902836:1 gene:ENSNLEG00000014096 transcript:ENSNLET00000018083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRQVCRFRHMEIDKK
RSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSKTVLPTVPESPEEEVKASQLSV
QQNKLSVQSNPSPQLRSVMKVESSENVPSPTHPPVVINAADDDEDDDDQFSEEGDETKTP
TLQPTPEVHNGLRVTSVRKPAVNIKQGECLNFGIKTLEEIKSKKMKEKSKKQGEGSSGVS
SLLLHPEPVPGPEKENVRTVVRTVTLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLK
RSLAQRLGKKVETPETNIDKTPKKAQVSKSLKERLGMSADPNNEDATEKVNKVGEIHVKT
LEEILLERASQKRGELQTKLKTEGPSKTDDSTSGARSSSTIRIKTFSEVLAEKKHRQQEA
ERQKSKKDTTCIKLKTDSEIKKTVVLPPIVASKGQSEEPAGKTKSMQEVHIKTLEEIKLE
KALRVQQSSESSTSSPSQHEATPGARRLLRITKRTGMKEEKNLQEGNEVDSQSSIRTEAK
EASGETTGVDITKIQVKRCETMREKHMQKQQEREKSVLTPLRGDVASCNTQVAEKPVLTA
VPGITRHLTKRLPTKSSQKVEVETSGIGDSVLNVKCAAQILEKRGKAKPKVNVKPSVVKV
VSSPKLAPKRKAVEMHPAVIAAVKPLSSSSVLQEPPAKKAAVAVVPLVSEDKSVTVPEAE
NPRDSLVLPPTQSSSDSSPPEVSGPSSSQMSVKTRRLSSASTGKPPLSVEDDFEKLIWEI
SGGKLEAEIDLDPGKDEDDLLLELSEMIDS
Download sequence
Identical sequences A0A2I3GXI5
XP_003273192.1.23891 XP_003273193.1.23891 XP_012362208.1.23891 XP_012362209.1.23891 XP_012362210.1.23891 XP_012362211.1.23891 ENSNLEP00000017219 ENSNLEP00000017219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]